PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010940850.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family NAC
Protein Properties Length: 387aa    MW: 43458.3 Da    PI: 6.9253
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010940850.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM166.68.6e-52111391128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvka...eekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                     +ppGfrFhPt+eel+++yL+kkv+++k++l +vi++vd++k+ePwd+++k++     +++wyfFs++dkky+tg+r+nrat++g+Wkatg+dk +
  XP_010940850.1  11 VPPGFRFHPTEEELLNYYLRKKVASEKIDL-DVIRDVDLNKLEPWDIQEKCRIgstPQNDWYFFSHKDKKYPTGTRTNRATAAGFWKATGRDKVI 104
                     69****************************.9***************964443122456************************************ PP

             NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                     ++ + + +g++ktLvfykgrap+g+k+dW+mheyrl
  XP_010940850.1 105 YT-SFKRIGMRKTLVFYKGRAPHGQKSDWIMHEYRL 139
                     **.8889***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.28E-577174IPR003441NAC domain
PROSITE profilePS5100556.84811174IPR003441NAC domain
PfamPF023657.7E-2812139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009809Biological Processlignin biosynthetic process
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0009901Biological Processanther dehiscence
GO:0010047Biological Processfruit dehiscence
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 387 aa     Download sequence    Send to blast
MSISVNGQSC VPPGFRFHPT EEELLNYYLR KKVASEKIDL DVIRDVDLNK LEPWDIQEKC  60
RIGSTPQNDW YFFSHKDKKY PTGTRTNRAT AAGFWKATGR DKVIYTSFKR IGMRKTLVFY  120
KGRAPHGQKS DWIMHEYRLD DHSDSNPQSH VGLWSLGEAT SQEDGWVVCR VFKKKNHHKA  180
MDSPNNCSSI TSDAKTQMIH SGSDDALDQI LQYMGRSCKQ ESEAISNHSM SSNPNNLGIR  240
YLRPIETTLG ASLHQRFMKL PALESPTINP SLSNEYHPPP SDHPCGNQMG YTLESIHAVV  300
NMDSAYHAEA GINDWAALDR LVASHLNGQS EASKQLACFD DPSFNYCSTA KLPNNSQDYN  360
HGGGGGDEDL WSFTRSASSD HISHVSL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B5e-50817614167NAC domain-containing protein 19
4dul_A5e-50817614167NAC domain-containing protein 19
1ut7_B5e-50817614167NO APICAL MERISTEM PROTEIN
1ut7_A5e-50817614167NO APICAL MERISTEM PROTEIN
1ut4_B5e-50817614167NO APICAL MERISTEM PROTEIN
1ut4_A5e-50817614167NO APICAL MERISTEM PROTEIN
3swp_D6e-50817617170NAC domain-containing protein 19
3swp_C6e-50817617170NAC domain-containing protein 19
3swp_B6e-50817617170NAC domain-containing protein 19
3swp_A6e-50817617170NAC domain-containing protein 19
3swm_D6e-50817617170NAC domain-containing protein 19
3swm_C6e-50817617170NAC domain-containing protein 19
3swm_B6e-50817617170NAC domain-containing protein 19
3swm_A6e-50817617170NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00321DAPTransfer from AT2G46770Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010940850.10.0PREDICTED: NAC domain-containing protein 43-like
SwissprotQ84WP61e-123NAC43_ARATH; NAC domain-containing protein 43
TrEMBLM0SDZ01e-161M0SDZ0_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr3P12230_0011e-160(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP159738112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46770.11e-114NAC family protein